Skip to main content

Table 1 Sequence of peptide antigens used for in-house ELISA

From: Detection of circulating natural antibodies to inflammatory cytokines in type-2 diabetes and clinical significance

Antigen Sequence
IL1α LLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGP
IL1β LNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVF
IL6 TCLVKIITGLL EFEVYLEYLQNRFESSEEQARAVQM
IL8 ELRCQCIKTYSKPFHPKFIKELRVIESGPH
TNF-α LIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLS